Summary

The peptide backbone of a beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as balls and sticks. Stabilizing H-bonds between the peptide backbone atoms are highlighted.

Protein Data Bank ID: 1A0S
Segmentation Software: Cura 4.5
3D Modeling/CAD Software: Chimera
Model Origin: Molecular data (e.g., crystallography)

Print Settings

Printer Brand:

Creality

                                            <p class="detail-setting printer"><strong>Printer: </strong>                     <div><p>Ender 5</p></div></p>                                                                                <p class="detail-setting rafts"><strong>Rafts: </strong>                     <div><p>Doesn't Matter</p></div></p>                                                                                <p class="detail-setting supports"><strong>Supports: </strong>                     <div><p>Yes</p></div></p>                                                                                <p class="detail-setting resolution"><strong>Resolution: </strong>                     <div><p>0.2</p></div></p>                                                                                <p class="detail-setting infill"><strong>Infill: </strong>                     <div><p>20</p></div></p>                                                    <strong>Filament:</strong> generic PLA                    <br>                        <p class="detail-setting notes"><strong>Notes: </strong>                    </p><div><p>The model was re-orientated using the Auto-orientation plugin in Cura. Printed at 0.2 resolution with wall 4 lines. I have used concentric supports and found to be easier to remove. </p></div>

A beta-sheet from a sucrose specific porin - peptide backbone as balls and sticks