A beta-sheet from a sucrose specific porin as cartoon with the side-chains visible

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized as a cartoon. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted.

I made this to use it for teaching Biochemistry and Structural Biology.

Protein Data Bank ID: 1A0S
Segmentation Software: CURA
3D Modeling/CAD Software: Chimera
Model Origin: Molecular data (e.g., crystallography)